Total number of results for Gadus morhua are 6
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00816 |
ACNTATCVTHRLADFLSRSGGIGNSNFVPTNVGSKAF
|
37 | Gadus morhua | Calcitonin | Calcitonin gene-related peptide | 9688955#Shahbazi F, Karila P, Olsson C, Holmgren S, Conlon JM, Jensen J#Primary structure, distribution, and effects on motility of CGRP in the intestine of the cod Gadus morhua#Am J Physiol 1998 Jul;275(1 Pt 2):R19-28 | |
| NP02324 |
HSDAVFTDNYSRFRKQMAAKKYLNS
|
25 | Gadus morhua | Glucagon | Vasoactive intestinal peptide | #Thwaites D.T., Young J., Thorndyke M.C., Dimaline R.#Isolation and characterisation of two teleost VIP's.# Regul. Pept. 21:436-436(1988). | |
| NP03882 |
YPIKPENPGEDAPADELAKYYSALRHYINLITRQRY
|
36 | Gadus morhua | NPY | Neuropeptide Y | 1459125#Jensen J., Conlon J.M.; #Characterization of peptides related to neuropeptide tyrosine and peptide tyrosine-tyrosine from the brain and gastrointestinal tract of teleost fish.; #Eur. J. Biochem. 210:405-410(1992). | |
| NP05443 |
SPVDCREEQAGSSQCPTISQEKLLDRVIQHTELIYRVSEESCSMFEDMFVPFPVRLQRNQAGNTCITKDFPIPTSKNELQQISDTWLLHSVLMLVQSWIEPLVYLQTTLDRYDDVPDVLLNKTKWMSEKLISLEQGVVVLIRKMLDGAILNSSYNEYSAVQLDVQPEVLESILRDYNVLCCFKKDAHKIETILKLLKCRQIDKYNCALY
|
209 | Gadus morhua | Somatotropin/prolactin | Somatolactin | 1993170#Rand-Weaver M., Noso T., Muramoto K., Kawauchi H.#Isolation and characterization of somatolactin, a new protein related to growth hormone and prolactin from Atlantic cod (Gadus morhua) pituitary glands.# Biochemistry 30:1509-1515(1991). | |
| NP05678 |
KPRPQQFIGLM
|
11 | Gadus morhua | Tachykinin | Substance P | 1376687#Jensen J., Conlon J.M.; #Substance-P-related and neurokinin-A-related peptides from the brain of the cod and trout.; #Eur. J. Biochem. 206:659-664(1992). | |
| NP05679 |
HKINSFVGLM
|
10 | Gadus morhua | Tachykinin | Neurokinin A | 1376687#Jensen J., Conlon J.M.; #Substance-P-related and neurokinin-A-related peptides from the brain of the cod and trout.; #Eur. J. Biochem. 206:659-664(1992). |